SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6T792 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6T792
Domain Number 1 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 177-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 88-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-17
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 9 Region: 362-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000313
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 138-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000274
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 222-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000407
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 12 Region: 58-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000105
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6T792
Sequence length 555
Comment (tr|A0A2K6T792|A0A2K6T792_SAIBB) Zinc finger protein 791 {ECO:0000313|Ensembl:ENSSBOP00000015509} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=ZNF791 OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MDSVAFEDVSVNFSQEEWALLAPSQKKLYRDVMQETFKNLVSISHKVERLCESKEGSQCG
ETFSPSLCVTKKTARVKLDECTVCGKVFTRRSSLTRHMRSHTGYELIEKPYKCKECGKAF
SYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQTHERTHIGEKPYECKQCGKALSCPS
SLRIHERIHTGEKPYECKKCGKAFSCPSSIRIHERTHTGEKPYACKECGKAFISHTSVLT
HMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPYKCKQCGKAFRCSTSIQIHERT
HTGEKPYKCKECGKSFSARPAFRVHLRVHTGEKPYKCKECGKAFSRTSYFRIHERTHTGE
KPYECKKCGKTFNYPLDLQIHERNHTGEKPYECKECAKAFISLENFRRHMITHTGDGPYK
CRDCGKAFIFPSALRTHERTHTGEKPFECKQCGKAFSCSSYIQIHERTHTGEKPYECKEC
GKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQRHERIHSCEKPLECKQCGKAF
ILSTSLQKHMRMHTR
Download sequence
Identical sequences A0A2K6T792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]