SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6TBH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6TBH2
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.06e-38
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 172-283
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000283
Family Tissue inhibitor of metalloproteinases, TIMP 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6TBH2
Sequence length 296
Comment (tr|A0A2K6TBH2|A0A2K6TBH2_SAIBB) Secreted frizzled related protein 2 {ECO:0000313|Ensembl:ENSSBOP00000016979} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=SFRP2 OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MLQGPGSLLLLVLAPHCCLGSAHGLFLFGQPDLSYKRSNCKPIPTNLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLDCDRFPQDNDLCIPLASSDHVLPTTTEEAPKVCEACKTKN
DDDNDIMETLCKNDFALKIKVKEITYINGDTKIILETKSKTIYKLNGVSEKDLKKSVLWL
KDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences A0A2K6TBH2 F7E410
XP_002745425.1.60252 XP_003928010.1.74449 ENSCJAP00000003457 ENSCJAP00000003457 ENSCJAP00000047561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]