SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6TGG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6TGG0
Domain Number 1 Region: 369-478
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.31e-19
Family Anthrax protective antigen 0.012
Further Details:      
 
Domain Number 2 Region: 1827-1907
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000107
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 
Domain Number 3 Region: 2088-2175
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000374
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 4 Region: 1154-1231
Classification Level Classification E-value
Superfamily E set domains 0.000000000000016
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 
Domain Number 5 Region: 1911-1994
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000336
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 6 Region: 1236-1316
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000904
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 7 Region: 1997-2082
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.023
Further Details:      
 
Domain Number 8 Region: 3290-3373,3402-3525
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000489
Family Galacturonase 0.085
Further Details:      
 
Domain Number 9 Region: 1655-1742
Classification Level Classification E-value
Superfamily E set domains 0.000000000014
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 10 Region: 1063-1141
Classification Level Classification E-value
Superfamily E set domains 0.0000000000318
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 11 Region: 269-358
Classification Level Classification E-value
Superfamily E set domains 0.000000000205
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number 12 Region: 1560-1631
Classification Level Classification E-value
Superfamily E set domains 0.000000000644
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 13 Region: 1328-1385
Classification Level Classification E-value
Superfamily E set domains 0.000000000815
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 
Domain Number 14 Region: 1745-1820
Classification Level Classification E-value
Superfamily E set domains 0.0000000021
Family Other IPT/TIG domains 0.086
Further Details:      
 
Domain Number 15 Region: 32-125
Classification Level Classification E-value
Superfamily E set domains 0.00000000764
Family Other IPT/TIG domains 0.088
Further Details:      
 
Domain Number 16 Region: 143-236
Classification Level Classification E-value
Superfamily E set domains 0.0000000132
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 17 Region: 1403-1499
Classification Level Classification E-value
Superfamily Cupredoxins 0.000000199
Family Plastocyanin/azurin-like 0.039
Further Details:      
 
Domain Number 18 Region: 2367-2377,2474-2683
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000942
Family Galacturonase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6TGG0
Sequence length 4243
Comment (tr|A0A2K6TGG0|A0A2K6TGG0_SAIBB) PKHD1 like 1 {ECO:0000313|Ensembl:ENSSBOP00000018710} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=PKHD1L1 OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MGHLWLLGIWGLWGLLLCAANPRADGSEIIPKVTEIIPKYGSINGATRLTIRGEGFSQAN
QFNYGADNTELGNSVQLVSSFQSIACDVEKDASHSTHITCYTRAMPEGSYTVRVSVDGVP
VTENNTCKGHINSWACTFNAKSFRTPTIRSITPLSGTPGTLITIQGRIFTDVYGSNIVRS
SNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNGDMGSMICKTTGTFIGKSENLTF
FLNRSLPQKMAYFVSSLSKISMFQTYAEVTAIFPSRGSIQGGTMLTISGRFFDQTDFPVR
VLVGGETCDTLNVTENSISCKTPPKPHILKTVYPGGRGLKLEVWNNSRPVHLEEILEYNE
KTPGYMEASWVDSPSYIWPMEQDTFVARFSGFLVAPDSDVYRFYIKGDDRYAIYFSQTGL
PEDKVRIAYHSANANSYFSSPAQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQYQN
VYTEQQTGDAVNEEQVIKSQSTIIQEVQVITLENWETTNAINEVQKIKITSPCVEANSCS
LYQYRLIYNMEKTVFLPADASEFILQSSLNDLWSIKPDTVQVIRTQNTQSYIYTITFIST
RGDFDLLGYEVFEGNNVTLDITEQTKGKPNLETFTLNWDGIASKPLTPWSSEAEFQRAVE
EMVSTKCPPQITNFEEGFVVKYFRDYETDFNLDRINRGQKTAETDAYCGRYSLKNPAVLF
DSADVKPNRLPYGDILLFPYNQLCLAYKGFLANYIGLKFQYQDTSKIIRSTDVQFTYNFA
YGNNWTYTCIDLLDLIRTKYTGTNISLQRISLQKASESQSFYVDVMYIGHTSTISTLDEM
PKRRLPALANKGIFLEHFQVNRTKINGPTMTYQYFVTMTSYNCSYNIPMMAVSFGQIITH
ETENEIVCRGNNWPGESKIHIQRIQAASPPLSGSFDIQAYGRILKGLPAGVSAADLQFAL
QSLEGMGRVSVTREGTCAGYTWNIKWRSTCGKQNLLQINDSNIIGEKANMTVTRIKEGGL
FRQHILGDLLRTPSQQPQVEVYVNGIPAKCSGDCGFTWDSAITPLVLGTSPSQGSYEEGT
ILTIVGSGFSPSSAVTVSVGAGGCYLLSVDEKEIKCQILKGSAGHAPVAVSIADVGLAQN
VGGEEFYFVYQSQISHIWPDSGSIAGGTLLTLSGFGFNENSKVFVGNETCDVIEGDLNRI
TCRTPKKTEGTVDISVTTNGFQATARDAFSYNCLQTPIITDFSPKVRTILGEVNLTVNGY
NFGNELTQNMVVYVGGKTCQILHWNFTDIRCLLPKLPPGKHDIYVEVRNWGFASTRDKLN
SSIQYVLEVTSMFPQRGSLFGGTEITIRGFGFSTIPAENTVLLGSIPCNVTSSSENVIKC
ILHSTGNIFRITNNGKDSVHGLGYAWSPSVLNVSVGDTVTWHWQTHPFLRGIGYRVFSVS
SPGSVIYDGKGFTNGRQKSTSGSFSYQFTSPGIHYYSSGFVDEAHSIFLQGVINVLPAET
RHIPLHLFVGSSEATYAHGGPENLHLGSSVAGCLATEPLCGLNNTRVKNSERLLFEVSSC
FSPSISNITPSSGTVNELITIIGHGFSNLPCANKITIGSYPCVIEESNDDSITCHIDPQN
SMDVGIREIVTLTVYNLGTAINTLSNEFDRRFVLLPNIDLVLPNVGSTTGMTRVTIKGSG
FAVSSAGVEVLMGHFPCKVLSVNYTAIECDTSPAVQQLVDVYLLIHGVPAHCQGNCTFSY
LESITPYITGISPNSIIESVKVIIEGEGFGTVLDDIAVYIGNQQFRAIDVNENNITAVVT
SLPVGRHSLSVVVRSKGLALGNLSVSSPPVASVSPTSGSIGGGTTLVITGNGFYPGNTTV
TIGDDPCQIIFVNPNKVYCHTPPGTAGMVGVKIFVNTISYPPLLFTYALEDTPFLRGIVP
SRGPPGTEIEITGSNFGIEILDISVMINNIQCNVTMANDSVLQCIVGDHAGGTFPVMMHH
KTKGSAVSTVVFEYPLNIQNINPSQGSFGGGQTMTVTGTGFNPQNSVILVCGSECAVDRL
RSDYTTLLCEIPSNNGRGAEQACEVSVINGKDLSQSTTPFTYAVFLTPLITAVSPKRGST
AGGTRLTVMGSGFSENIEDVHITIAEAKCAVECSNKTHIICMTNAHPLSGWAPVHVHIRG
VGMAKLDNADFLYVDAWSSNFSWGGRSPPEEGSLVVISKGQTILLDQSTPILKMLLIQGG
TLIFDEADIELQAENILITDGGILQIGTETSPFQHKAVITLHGHLRSPELPVYGAKTLAV
REGILDLHGVPVPVIWTRLAHTAKAGERILILQEAVTWKPGDNIVIASTGHRHSQGENEK
RIIASVSADGVTITLSNPLNYTHLGITVTLPDGTLFEARAEVGILTRNILIRGSDNVEWN
KKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCIMFHAPVPGANMVTGRIEYVEVF
HTGQAFRLGRYPIHWHLLGDLHFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYDIRG
GAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAVAGGTHFG
FWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGMWIFEEYFPMQTGSCTSTVP
VPARFNSFTAWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPYVGGWGETNGAM
IKNAKIVGHLDELGMGSAFCTRKGLVLPFSEGLTVSCVHFMNFDHPNCVALGVTSISGVC
NDRCGGWSAKFVDIQYFHTPNKAGFRWEHEMVLIDVDGSLTGHKGHTVIPHSSLLDPSHC
TQEAEWSIGFPGSVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFGTSIIPFQKKRLTHM
SGWMALIPNANHINWYFKGVDHITNISYTSTFYGFKDEDYVIISHNFTQNPDMFNIIDMR
NGSSNPLNWNTSRNGDWHLEANTSTLYYLVSGRNDLQESQPISGNLDPDVKDVVINFQAY
CCILQDCFPVHPPSRKPMPKKRPATYNLWSNDSFWQSSRENNYTVPHPGANVIIPEGIWI
VADIDMPSMERLIIWGVLELEDKYNVGAAESSYREVVLNATYISLQGGRLIGGWEDNPFK
GDLKIVLRGNHTTRDWALPEGPNQGSKMLGVFGELDLHGIPRSIYKTKLSETADAGSKIL
SLMDAVDWQEGEEVVITTTSYDFHQTETRSIVKILHDRKILILNDSLSYTHFAEKYHVPG
TGESYTLAADVGILSRNIKIVSEDYPGWSQDSFGAHVLVGSFTENMMTFKGNARISNVEF
YHSGQEGFRDSTDPRYAVTFLNLGQIQEHGSSYIQGCAFHHGFSPAIGVFGTDGLDIDDN
IIHFTVGEGIRIWGNANRVRGNLIALSVWPGTYQNRKDLSSTLWHAAIEINGGTNTVLQN
NVVAGFARAGYRIDGEPCPSQFNPVEKWFDNEAHGGLYGIYMNQDGLPGCSLIQGFIIWT
CWDYGIYFQTTENVYIYNVTLVDNGMAIFPMIYLPAAISHKISNKKVQIKSSLIVGSSPG
FNCSDILTNDDPNVELTAAHRSPRSPSGGRSGICWPTFASAHNMAPQKPHAGIMSYNAIS
GLLDISGSTFVGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIKLVDTTEQSKIFIHRPD
ISKVNPSDCVDMVCDAKRKSFLRDIDGSFLGNAGFVIPQAEYEWDGNSQLGIGDYRIPKV
MLTFLNGSKIPVTEKAPYKGIIRDSTCKYIPQWQSYQCFGMEYALMVIESLDPDTETRRI
SPVAIMGNGYVDLLNGPQDHGWCAGYTCQRRLSLFHSIVALNKSYEIYFTGTSPQNLRLM
LLNVDRNKAVLVGIFFSTLQRLDVYVNNSLVCPKNTIWNAQQRHCELNTLLYKDQFLPNL
DSTVLGENYFDRTYQMLYLLVKGTIPVEIHTATVIFVSFQLPAVTEDDFYTSHNLVRNLA
LFLKIPSDKIRVSKMTRQKSLRRKRSIGFIIEIEIGDPPIQFLNNGTTGQMQFSELQETA
GSLGQAVILGKISSILGFNISSISITNPLPSPSDSGWIKVTAQPVERSAFPVHHVAFVSS
LSVITQPVAAQPGQPFPQQPSVKATDSDGNCVSVGITALTLRAILKDSNNNQVSGLSGNT
TIPFSSCWANYTDLTPLRTGKNYKIEFLLDNVVRVESRTFSLQAESVSSSSSSSGSSSSN
SKASTVGTSAQIMTVVISCLIGRMWLLEIFMAAVSTVNITLSK
Download sequence
Identical sequences A0A2K6TGG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]