SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6U5T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6U5T7
Domain Number 1 Region: 64-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000734
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6U5T7
Sequence length 347
Comment (tr|A0A2K6U5T7|A0A2K6U5T7_SAIBB) Tumor suppressor candidate 3 {ECO:0000313|Ensembl:ENSSBOP00000027230} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=TUSC3 OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK
Download sequence
Identical sequences A0A096NBR4 A0A0D9RW64 A0A2I2Y386 A0A2K5M7S2 A0A2K5X4U9 A0A2K5XMS0 A0A2K6DCC0 A0A2K6P509 A0A2K6U5T7 E2RDD3 F7C9S5 F7EWS4 H2PPL9 K7CVL3 K9IXD8 M3YJD9
ENSPPYP00000020590 NP_839952.1.87134 NP_839952.1.92137 XP_001140529.1.37143 XP_003734633.1.60252 XP_003777259.1.23681 XP_003797705.1.62490 XP_003935602.1.74449 XP_004597896.1.84141 XP_004757893.1.14098 XP_005562703.1.63531 XP_006727457.1.47382 XP_007959904.1.81039 XP_010356458.1.97406 XP_011843734.1.47321 XP_015000275.1.72884 XP_018888202.1.27298 XP_020138370.1.48125 ENSPPYP00000020590 gi|30410790|ref|NP_839952.1| 9544.ENSMMUP00000009263 9600.ENSPPYP00000020590 ENSCJAP00000022010 ENSMMUP00000009263 ENSCAFP00000010164 ENSMPUP00000011446 ENSMMUP00000009263 ENSPANP00000010219 ENSP00000371450 ENSCJAP00000021986 ENSMPUP00000011446 ENSP00000371450 ENSCAFP00000010164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]