SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6UL83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6UL83
Domain Number 1 Region: 1247-1559
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-113
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000118
Further Details:      
 
Domain Number 2 Region: 1523-1811
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.71e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000107
Further Details:      
 
Domain Number 3 Region: 315-509
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-44
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 4 Region: 507-702
Classification Level Classification E-value
Superfamily Fibronectin type III 1.63e-42
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 5 Region: 18-112
Classification Level Classification E-value
Superfamily Immunoglobulin 7.23e-18
Family I set domains 0.0043
Further Details:      
 
Domain Number 6 Region: 122-221
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 7 Region: 227-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000194
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 917-981
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000948
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6UL83
Sequence length 1819
Comment (tr|A0A2K6UL83|A0A2K6UL83_SAIBB) Protein tyrosine phosphatase, receptor type S {ECO:0000313|Ensembl:ENSSBOP00000032670} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=PTPRS OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
PTRCPDPPAPPLPAVSPEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKV
NSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQLPSG
FPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGECG
WLTGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRGRELRRVAPRFSILPMSHEI
MPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSS
LGVIEAVAQITVKSLPKAPGTPVVTENTATSITITWDSGNPDPVSYYVIEYKSKSQDGPY
QIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQAR
MLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDET
YTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSITLSWSPPRQESIIKY
ELLFREGDHGREVGRTFDPTTSYVVEDLKPSTEYAFRLAARSPQGLGAFTPVVRQRTLQS
KPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNGIPP
TTTQILLEALEKWTEYRITTVAHTEVGPGPESSPVVVRTDEDGKCLPQDRDPAPAPARPP
PRSLPVVLMVVIQRPGWTETRLSRWPRSVWETDDTAEYVSSARATHGDGARSKPKVVVTK
GAGMRPAHPHSGPSPPLAPEHAPRVLYLGRVSSRVVQEQLTDSCGLRPRPHPHPLLGDPW
GHSTDSVPDILGLPAGHTASCDLSVPSSQQGTSLLSQGHCIGPDTAYDLQVRAHTRRGPG
PFSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDG
RTTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFSVLNGKPSVAPKPDADGFIM
VYLPDGQSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISRLQRRSLRHS
RQLEVPRPYIAARFSVLPSTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAALQKTEPTFAA
SPFSDPFQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIISPRPPLRDNSEPRTKCLLNNAD
LAPHHPKDPVEMRRINFQTPDSGLSSPLREPGFHLESMLSHPPIPIADMAEHTERLKAND
SLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIVGSDYINA
NYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRG
TETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLA
FLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRN
YMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLAN
SKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKA
YIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDP
MAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQ
FGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEY
QFCYQAALEYLGSFDHYAT
Download sequence
Identical sequences A0A2K6UL83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]