SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6UPP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6UPP0
Domain Number 1 Region: 955-1029
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000133
Further Details:      
 
Domain Number 2 Region: 628-705
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.24e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 877-953
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000126
Further Details:      
 
Domain Number 4 Region: 360-451
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000686
Family Eukaryotic type KH-domain (KH-domain type I) 0.000054
Further Details:      
 
Domain Number 5 Region: 771-823,853-876
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000731
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 79-142
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000129
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000327
Further Details:      
 
Domain Number 7 Region: 561-627
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000661
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000277
Further Details:      
 
Domain Number 8 Region: 261-348
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000092
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000084
Further Details:      
 
Domain Number 9 Region: 422-516
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000506
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 10 Region: 699-775
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000628
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 11 Region: 1025-1093
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000111
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000577
Further Details:      
 
Domain Number 12 Region: 206-281
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 13 Region: 494-559
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000395
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6UPP0
Sequence length 1164
Comment (tr|A0A2K6UPP0|A0A2K6UPP0_SAIBB) Uncharacterized protein {ECO:0000313|Ensembl:ENSSBOP00000033894} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN= OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
VPGVASGSKPYPQQPVGPTLAPAHKLKPLAASSSRGGGGSASMSACSQLSLAKDQGLSIT
VSGKLDAVTKARKDTAARLQTQAAATVALPKERHRFVIGKNGEKLQDLELKTATKIQIPC
PDDPSNQIKITGTKEGIEKAHHEDLLISAEQDKHAVRGWLARSCRRQGRAHINIPPPSVN
RTEIVFTREKEQLAQAVAPIRKIYKEKKKKTTTITMEVKKSQPKYVMGPKHNSLKEILER
ASVSVEIPSSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVATPSWLHSFIIGKKG
QNPAKIIQQMPQVHIEFTEGKGKTTLEAPTKDVSVAQEQIESMVKDLINQMDYVEININQ
FHRHLLGKSGANINRIKDQYKVSVRIPPDREKNNLIRIEGDPQGVQQVKRELLELASRME
NERTKDLIIEQRFLRTIIGQKGERIREICDKFPEVIINFPDPAPKSDIVQLRGPKNEVEK
CTKYMQKMVTDLVENSYSISGPIFKQCHKNIIGKGGESNTNIDLPAENSNSETIIITGKR
AHCKAARSRILSIQKDLANMAEVSIPAKPHNSLVGTKGRLICSIMEECGGVHVHFPVEGS
GSDTLAIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFVIGKGGGKIHKVRD
STGARVVFPAARDKDQDLITIIGKEDAVQEAKKEVEAFIQNLDNVVEDYMLVDPRHHRHF
VIQRGQVLQETAEEYGGVMVSLPRSGTHSDKVTLKGTKDCVEAAKKCIQEITENLEAQVT
LECAIPQKFHPSVMGPKGSRIQQITRDFNVQIKFPGREENPVHSVGPAVQENGDKAGEGR
EAKDADPGSPRRCDIIIVSGRKETCEAAKEALQALVPVTIEVEVPFDLHRYIIGQKGSRS
RKMMDEFEVNTHVPAPELQSDIIAITGLAANLDRAKAGLLEHVKELQAEQEDRALRSFKL
SVTVDPKYHPKIIGRKGAVITQIQLEHDMNIHFPDKDDGSQPQDQITITGYEKNPEAARD
AIWRIVGELEQMVSEEVPLDHRVHARIIGAQDKVIRKIMDEFKVDIRFPQSGAPDPNCVT
EATDHILNLEEEYLADAVDSEALQVYMKRLAHEEAKAPSRGFVVRDAPWAASSSEKAPNM
SSSEEFPSFRAQVAPKTLPWGPKQ
Download sequence
Identical sequences A0A2K6UPP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]