SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6UPP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6UPP9
Domain Number 1 Region: 973-1047
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.92e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000133
Further Details:      
 
Domain Number 2 Region: 646-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.26e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 895-971
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000126
Further Details:      
 
Domain Number 4 Region: 378-469
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000699
Family Eukaryotic type KH-domain (KH-domain type I) 0.000054
Further Details:      
 
Domain Number 5 Region: 789-841,871-894
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 97-160
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000327
Further Details:      
 
Domain Number 7 Region: 579-645
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000675
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000277
Further Details:      
 
Domain Number 8 Region: 279-366
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000935
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000084
Further Details:      
 
Domain Number 9 Region: 440-534
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000393
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 10 Region: 717-793
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 11 Region: 1043-1111
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000113
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000577
Further Details:      
 
Domain Number 12 Region: 224-299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 13 Region: 520-575
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000253
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6UPP9
Sequence length 1182
Comment (tr|A0A2K6UPP9|A0A2K6UPP9_SAIBB) Uncharacterized protein {ECO:0000313|Ensembl:ENSSBOP00000033868} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN= OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MVGDSEPGEGRASALSDLRCFQRSREEGDGLEAGQAPAGWGGTSRRQLLFARQGGGGSAS
MSACSQLSLAKDQGLSITVSGKLDAVTKARKDTAARLQTQAAATVALPKERHRFVIGKNG
EKLQDLELKTATKIQIPCPDDPSNQIKITGTKEGIEKAHHEDLLISAEQDKHAVRGWLAR
SCRRQGRAHINIPPPSVNRTEIVFTREKEQLAQAVAPIRKIYKEKKKKTTTITMEVKKSQ
PKYVMGPKHNSLKEILERASVSVEIPSSDSISETVILRGEPEKLGQALTEVYAKANSFTV
SSVATPSWLHSFIIGKKGQNPAKIIQQMPQVHIEFTEGKGKTTLEAPTKDVSVAQEQIES
MVKDLINQMDYVEININQFHRHLLGKSGANINRIKDQYKVSVRIPPDREKNNLIRIEGDP
QGVQQVKRELLELASRMENERTKDLIIEQRFLRTIIGQKGERIREICDKFPEVIINFPDP
APKSDIVQLRGPKNEVEKCTKYMQKMVTDLVENSYSISGPIFKQCHKNIIGKGGESNTNI
DLPAENSNSETIIITGKRAHCKAARSRILSIQKDLANMAEVSIPAKPHNSLVGTKGRLIC
SIMEECGGVHVHFPVEGSGSDTLAIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPE
YHKFVIGKGGGKIHKVRDSTGARVVFPAARDKDQDLITIIGKEDAVQEAKKEVEAFIQNL
DNVVEDYMLVDPRHHRHFVIQRGQVLQETAEEYGGVMVSLPRSGTHSDKVTLKGTKDCVE
AAKKCIQEITENLEAQVTLECAIPQKFHPSVMGPKGSRIQQITRDFNVQIKFPGREENPV
HSVGPAVQENGDKAGEGREAKDADPGSPRRCDIIIVSGRKETCEAAKEALQALVPVTIEV
EVPFDLHRYIIGQKGSRSRKMMDEFEVNTHVPAPELQSDIIAITGLAANLDRAKAGLLEH
VKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIQLEHDMNIHFPDKDDGSQP
QDQITITGYEKNPEAARDAIWRIVGELEQMVSEEVPLDHRVHARIIGAQDKVIRKIMDEF
KVDIRFPQSGAPDPNCVTEATDHILNLEEEYLADAVDSEALQVYMKRLAHEEAKAPSRGF
VVRDAPWAASSSEKAPNMSSSEEFPSFRAQVAPKTLPWGPKQ
Download sequence
Identical sequences A0A2K6UPP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]