SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0B9J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0B9J0
Domain Number 1 Region: 88-315
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 1.37e-40
Family TM0189-like 0.0052
Further Details:      
 
Domain Number 2 Region: 30-85
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000183
Family Type I dockerin domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0B9J0
Sequence length 339
Comment (tr|A0B9J0|A0B9J0_METTP) Periplasmic binding protein {ECO:0000313|EMBL:ABK15364.1} KW=Complete proteome; Reference proteome OX=349307 OS=101360 / PT) (Methanosaeta thermophila). GN=Mthe_1596 OC=Methanosaetaceae; Methanothrix.
Sequence
MKGAYFLLAFLAIGMILSVPPISAYDFTLEIFGNANMDDAINEEDVAYIQGILNNEDKVT
EFADANYDGKIDSNDIDQIEAIIHNEEKELTLLDSAGRVATIKMPIKRIVAINRNGAETL
RTLKASDRIIGISDSALNDKSYFPEFREDQSIGSAKTPDIEKILNLDPDLVIYYGTQWTT
DYEIIRDTLNKTDPTISIIGLDCYKPDTYIEDVIKLGYIVGRVTEAYEFASWYEDKINTI
NNVVKQIPDDAKPRVYEGGRSDFYQTGGLGSQSHNVIVMAGGKNIFDDLSGEAITIDPES
VVERNPEFIIWKISNIGGYTLDKNETVKFQEKLLCWITI
Download sequence
Identical sequences A0B9J0
349307.Mthe_1596 gi|116754886|ref|YP_844004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]