SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0JM12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0JM12
Domain Number - Region: 801-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00395
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 408-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0144
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 322-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0275
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 672-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0318
Family Laminin-type module 0.013
Further Details:      
 
Domain Number - Region: 367-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.072
Family Laminin-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0JM12
Sequence length 1114
Comment (sp|A0JM12|MEG10_XENTR) Multiple epidermal growth factor-like domains protein 10 KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=megf10; OC=Silurana.
Sequence
MVHSLKWLGIFPLILFQWLGTTSSLNLEDPNVCSHWESYSVTVQESYSHPYDQVYYTSCT
DILNWFKCTRHRISYRTAYRRGEKTMYRRKSQCCPGFYESREMCVPHCADKCVHGRCIAP
NTCQCEPGWGGPNCSSACDVDHWGPHCSSRCQCKNGALCNPITGACHCSSGYKGWRCEER
CDQGTYGNDCQQKCQCQNGASCDHVTGECRCPPGYTGAFCEDLCPPGKHGSQCEERCPCQ
NGGVCHHVTGECSCPAGWMGTVCGQPCPEGRYGRNCSQECQCHNGGTCDSATGQCYCSPG
YNGERCQEECPVGLYGVKCAQTCQCLNGGKCYHISGACLCEPGYTGERCETPLCSEGTYG
MKCDKKCPCHLQYTQSCHPMSGECACKPGRSGLYCNETCSLGFYGEFCQQICSCQNGADC
DSVTGKCICAPGFTGVDCSTACPPGTYGVNCSSLCNCKNNAVCSPVDGSCTCKAGWHGVD
CSINCPRGSWGLGCNLTCQCLNGGACNPLDGTCTCAPGWRGLKCELPCQDGTYGMNCIER
CDCSHADGCHPATGYCRCLAGWAGMHCDSVCPGGHWGPNCSLSCDCKNGASCSPDDGICE
CAPGYRGTTCQRICSPGFYGHRCSQACPQCVHSNGPCHHVTGQCDCLAGFMGSLCNEVCP
SGRYGKNCAGVCACTNNGTCNPIDGTCQCYPGWIGNDCSQACPPGHWGPNCIHTCNCHNG
AYCSAYDGECKCSPGWTGLYCTQRCPLGYYGKECTLVCQCQNGADCDHITGQCTCRTGFM
GKFCEQKCPSASYGYGCRQVCDCLNNSTCDHITGTCYCSPGWKGARCDQAVMIVVGNLNS
LSRTSAAIPADSYQIGAIAGIIILVLVVLFLLALFIIYRQKQKGKDTAMPAVAYTPAVRV
LSTDYTIADTLPHNNVVNANSQYFSNPSYHTLSQCTTGPQVNSMDRMMVSRSKSSQLFVN
LKNLDPGKRSHTIDYTGTLPADWKQGGFLNENGLLKNSAYSISTCSLSSTENPYATIKDP
PVLLPKNIECGYVEMKSPARRDSAYAEISNSSLANKNVYEVEPTVSVVQGAFCNNGKISQ
DLYDLPKNSHIPCHYDLLPVRESSSSNKDESTSE
Download sequence
Identical sequences A0JM12
ENSXETP00000034579 NP_001072726.1.99540 gi|116487753|gb|AAI25697| gi|118404388|ref|NP_001072726| gi|160409991|gb|A0JM12| ENSXETP00000034579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]