SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0JMJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0JMJ7
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily Chromo domain-like 9.54e-18
Family Chromo domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0JMJ7
Sequence length 342
Comment (tr|A0JMJ7|A0JMJ7_DANRE) Chromobox homolog 8 (Pc class homolog, Drosophila) {ECO:0000313|EMBL:AAI25905.1} OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=cbx8 OC=Cyprinidae; Danio.
Sequence
MELSAVGERVFAAESIIKRRIRRGRMEYLVKWKGWSQKYSTWEPEENILDERLFAAFEER
EREREMYGPKKRGPKPETFLMKAKAKAKSKTYEFGREMSRDIRVSFPVAEPVVTPRAREG
LRTVVPTIFPPSTINRGESVRVRPPDSERDTLTHGTSIQCPLDFTNSPKKRGPKPKMHPA
GGSSSEGIKRKADESLSYRPSKTERSGETSNCDIMHFTQKYKAETNHDGKQMGSRSSDVK
FSHGGSFLKAGLGILGHRQKVGSGGAINQQAKMKHPPKNNLFRSTDQTREQLSLSFVDDT
DQSWLPCLKNMEKIVVTDVTSNSLTVTIKESSTDKGFFKENR
Download sequence
Identical sequences A0JMJ7
7955.ENSDARP00000095045 ENSDARP00000095045 ENSDARP00000095045 NP_991179.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]