SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0JPG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0JPG9
Domain Number 1 Region: 391-492
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 5.23e-29
Family FAD-dependent thiol oxidase 0.0027
Further Details:      
 
Domain Number 2 Region: 34-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-20
Family PDI-like 0.0071
Further Details:      
 
Weak hits

Sequence:  A0JPG9
Domain Number - Region: 202-239
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0578
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0JPG9
Sequence length 715
Comment (tr|A0JPG9|A0JPG9_XENLA) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} OX=8355 OS=Xenopus laevis (African clawed frog). GN=qscn6l1 OC=Xenopus.
Sequence
MGFSSSLCICGATLVLLLLTSVAPSQAALYSPDEPVVFLDTKARSYLLESRSFWLAEFYA
SWCGHCQNFKPTWSALAEDIKDWRPVVYLGVIDCAEASNSDTCTEFGVKGYPTVKSFKPF
TKEISEGVEEKDHTIQALRETIIKRLEEQKDSRPPACPPLEPISAYEVEQFFITHQEDYL
ALIFEEASMYIGRETALDMVQYEGVSVRRVHRDQDDIVNKFQIPSFPALVLLCKNGSNTI
VNMVEDTRSSYTNFLRSLPGVRKGNLPIIGMSSNNTTQQDNRRISDSSKLYLADLESAVH
YTLRAEVSRFSILNGERLNALIAYVSVLKKYFPARPYGRTLISSMYSWLRDRAGTEVLYK
DFQDVLDNKDKVEKAVLSSGVNFVWCQGSQSKFRGFPCSLWTLFHFLTVQAGEDKTANPM
EVLSVLREYVKHFFGCRECAGHFESMAAESMSKVSSLDDAILWLWDRHNRVNKRLSGAPS
EDPEFPKLPWPSKALCPLCQVEDGADELAWDSPNVLTFMKAHYSRENLASDYLEDEEVLL
ERQRNVTKKIETSKEKNESPFKLRYPSLITEDNKNENNPDADVPVHVKVEEEKNAGEANS
FLRSLLPSRSLQGSVEHDSDGAIMPQILLDIPEEEFDHIAVRKRLLRRGIDGNSYINVGA
EKGNLRWGKTLELGFSRLDISLCVVFYFLSSMCLLCMYLYMSLRKRCLRQRTFYP
Download sequence
Identical sequences A0JPG9
NP_001090556.1.7800 gi|117558573|gb|AAI27419| gi|148228311|ref|NP_001090556|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]