SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0LWH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0LWH2
Domain Number 1 Region: 147-403
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 7.85e-25
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0065
Further Details:      
 
Domain Number 2 Region: 60-178
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000314
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0LWH2
Sequence length 404
Comment (tr|A0LWH2|A0LWH2_ACIC1) Uncharacterized protein {ECO:0000313|EMBL:ABK53782.1} KW=Complete proteome; Reference proteome OX=351607 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B). GN=Acel_2010 OC=Acidothermus.
Sequence
MRGHLSWMGCAAAALVLVTACAAPNGQSPRAAGSAPGLAASKARNGSASPAGGASRGGAV
GAAAVRQLRLRGQIGVRLAGETLAVTHDGGRTWAPVSLPAGLAPANIAAVDSAPDGAPLL
AAVDPTGSVHVYRYAAEWSAVRLDPRWPAGTSTADGTEQVAFHPAAGGIVAVVVSLAGGG
FSAEHALFVSTDNGGHFGPPATPNGPDVNVRWSGLLMVTPRIGVLVAGPTQELLLRTTDG
GASWQRLSVPGVGGPGTFALGAPVLSGSRIDIPVTVQAAADGSREKFFLLASDDQGATFT
VRGVALDIPADFAPTGAVTGNTGSTWWVVAPSIGTVYETTDDGASWRTVHETGLALNTVA
VTLTGPAAATAVIAVNSCANDKSECTMTVTVEQTTDGGATWSPA
Download sequence
Identical sequences A0LWH2
gi|117929217|ref|YP_873768.1| 351607.Acel_2010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]