SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0LWJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0LWJ0
Domain Number 1 Region: 37-200
Classification Level Classification E-value
Superfamily PhoU-like 0.0000279
Family PhoU-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0LWJ0
Sequence length 205
Comment (tr|A0LWJ0|A0LWJ0_ACIC1) Uncharacterized protein {ECO:0000313|EMBL:ABK53800.1} KW=Complete proteome; Reference proteome OX=351607 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B). GN=Acel_2028 OC=Acidothermus.
Sequence
MRFRLTPEGPAFFDMFATSAATLVRGIQAASRIFLPDADRSAVADEVRRIEHEADEITHG
ILRRLNSTFVTPFDRDDIYRLAGRLDDVMDFVEAGTDLIVLYRLSELPQEIAEQVHVLER
AAAITADAMPRLRTRKGLDAYWIEVNRLENEADQLHRRLLAKLFDGHLDALTVLKLKEVS
DQFESAADAFENVANTVETIVVKET
Download sequence
Identical sequences A0LWJ0
351607.Acel_2028 gi|117929235|ref|YP_873786.1| WP_011720863.1.7777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]