SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0PV11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0PV11
Domain Number 1 Region: 20-292
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.64e-64
Family Carbon-carbon bond hydrolase 0.00000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0PV11
Sequence length 295
Comment (tr|A0PV11|A0PV11_MYCUA) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase BphD {ECO:0000313|EMBL:ABL06180.1} KW=Complete proteome OX=362242 OS=Mycobacterium ulcerans (strain Agy99). GN=MUL_4140 OC=Mycobacterium.
Sequence
MTVTQSKTAEHTFESTSRYAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGASSWSNFA
RNIEVLAQQFHVLAVDQPGYGHSDKRAEHGQFNHYAARALKELFDQLGLGRVLLVGNSLG
GGTAVRFALDYPDRAGRLVLMGPGGLSINLFAPDPTEGVKRLGKFSVAPTRENLEAFLRV
MVYDQKLITPELVDQRFELARTPESLAATRAMGKSFAAADFELGMMWREVYKLRQPVLLI
WGREDRVNPLDGALVALKTIPRAQLHVFGQCGHWAQVEKFDEFNRLTIDFLGGAR
Download sequence
Identical sequences A0PV11
362242.MUL_4140 WP_011741784.1.20315 gi|118619319|ref|YP_907651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]