SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0QVZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0QVZ0
Domain Number 1 Region: 18-283
Classification Level Classification E-value
Superfamily Cgl1923-like 1.19e-85
Family Cgl1923-like 0.000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0QVZ0
Sequence length 348
Comment (tr|A0QVZ0|A0QVZ0_MYCS2) Conserved hypothetical alanine and leucine rich protein {ECO:0000313|EMBL:ABK73799.1} KW=Complete proteome; Reference proteome OX=246196 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155). GN=MSMEG_2746 OC=Mycobacterium.
Sequence
MADNENPQQRYQPDQSGMYELEFPAPQLSSSDGRGPVLIHALEGFSDAGHAIRLAAEHLK
KSLDTELVASFAIDELLDYRSRRPLMTFKTDHFTAYEEPELNLYALHDTVGTPFLLLAGL
EPDLRWERFITAVRLLAEQLGVRQVIGLGTIPMAVPHTRPVNLTAHSNNKELIAEHTPWV
GEVQVPASVSNLLEFRMAQHGHEVVGFTVHVPHYLAQTAYPPAAEALLAEVARTGSLELP
LAALSEAGAEVYTKINEQVEASPEVAQVVSALERQYDAFIAAQENRSLLARDEDLPSGDE
LGAEFERFLAQQAGEKFKDDKYKDGHGEGFGGRIRGTVTTTDDVPDQG
Download sequence
Identical sequences A0QVZ0 I7G7B0
gi|118471616|ref|YP_887078.1| 246196.MSMEG_2746 gi|118471616|ref|YP_887078.1| WP_011728558.1.56412 YP_887078.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]