SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0RXU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0RXU0
Domain Number 1 Region: 8-172,199-216
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.85e-44
Family Ribonuclease PH domain 1-like 0.00000971
Further Details:      
 
Domain Number 2 Region: 186-266
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.15e-23
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0RXU0
Sequence length 270
Comment (tr|A0RXU0|A0RXU0_CENSY) Exosome complex component Rrp42 {ECO:0000256|HAMAP-Rule:MF_00622} KW=Complete proteome; Reference proteome OX=414004 OS=Cenarchaeum symbiosum (strain A). GN=CENSYa_1535 OC=Archaea; Thaumarchaeota; Cenarchaeales; Cenarchaeaceae; Cenarchaeum.
Sequence
MVHVTVIDELKRAKIAALLERGERIDGRRLDEPRKLTIETNAIPKAEGSARVHLGRTDVV
TGVKVQPDRPFPDVGDRGIFICTAEILPLAHPDVETGPPSPAVIELARVVDRGIRESGMV
DLSKLVLLKDKSVIGIFADSSVIDVDGNLFDACSYAATAAILTAKLPKWEIQDEAPVRIE
GETPVPVTTIPVSVTMAKINGHILVDPNQDEWAVMDARITITTNSDGNICALQKGGNSGF
THAELVKCGEISVRVGADIREIIKRAGGGS
Download sequence
Identical sequences A0RXU0
gi|118576718|ref|YP_876461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]