SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1A4Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1A4Q9
Domain Number 1 Region: 13-171
Classification Level Classification E-value
Superfamily Nudix 8.12e-20
Family MutT-like 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1A4Q9
Sequence length 195
Comment (sp|A1A4Q9|NUD16_BOVIN) m7GpppN-mRNA hydrolase KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NUDT16; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAGMRRLELSEALHLGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGG
FVDLRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQL
TAVEMGAPRARDHGLEVLGLVRVPLYTLRDGVGGLPAFLENTFIGNAREQLLEAVQNLGL
LEPGSFARLKISTPP
Download sequence
Identical sequences A1A4Q9
ENSBTAP00000049112 XP_005202022.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]