SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1A749 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1A749
Domain Number 1 Region: 33-81
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-16
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1A749
Sequence length 108
Comment (tr|A1A749|A1A749_DROME) IP17576p {ECO:0000313|EMBL:ABL75779.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN= OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPQIMNSKDKRNPNYSGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCGHHFCSQCIYN
WIRSQKYQAKCPYCQSLIGENTLITITMRRRRTYFRANPLWSTAARCA
Download sequence
Identical sequences A1A749
FBpp0111417 FBpp0111417 7227.FBpp0111417 FBpp0111417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]