SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1ARA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1ARA4
Domain Number 1 Region: 31-86
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000355
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1ARA4
Sequence length 179
Comment (tr|A1ARA4|A1ARA4_PELPD) Proteinase inhibitor I2, Kunitz metazoa {ECO:0000313|EMBL:ABK99874.1} KW=Complete proteome; Reference proteome OX=338966 OS=Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1). GN=Ppro_2267 OC=Desulfuromonadaceae; Pelobacter.
Sequence
MGNHPPVPLITYVSAALLLLCSACAPQGAVLADRCRLEPVNGPCKAMMERYRFDQKSGTC
REYIYDGCGAVVPFESLEECRQLCEPPASGEVQGKMPGVEPAVEKRSGLLRDPVEDDPRH
AVVFRNIDDEVKALLADHPRRGGEGFVNIYWETKKRLLKNRYGIDWRSPGEMNPQVIFD
Download sequence
Identical sequences A1ARA4
gi|118580682|ref|YP_901932.1| 338966.Ppro_2267 WP_011736134.1.31684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]