SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1B194 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1B194
Domain Number 1 Region: 86-218
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.96e-26
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 16-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.07e-17
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1B194
Sequence length 226
Comment (tr|A1B194|A1B194_PARDP) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABL69288.1} KW=Complete proteome; Reference proteome OX=318586 OS=Paracoccus denitrificans (strain Pd 1222). GN=Pden_1183 OC=Rhodobacteraceae; Paracoccus.
Sequence
MPFKEAEVPNLGLAPTASDIILKFIRDSIADGSLDEGEPIRQDDVARMFNVSKIPVREAL
KRLEAEGLVEFQRNKGAIVTSVSEPEIAQIFETRAILESNAIRLSVPHMTPETFTDAEEF
CDAFARETDVAQWSALNWQFHSRLYLDAQRPFLVRTIRSVNDRLERYLRIQLALSHGQGT
ADREHREILAACRAGDAEKAGKLVYDHIMGACSSLLHHLPASKSGR
Download sequence
Identical sequences A1B194
gi|119383928|ref|YP_914984.1| WP_011747508.1.25907 WP_011747508.1.3707 WP_011747508.1.52749 318586.Pden_1183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]