SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1B6E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1B6E3
Domain Number 1 Region: 16-279
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.29e-48
Family Atu1826-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1B6E3
Sequence length 282
Comment (tr|A1B6E3|A1B6E3_PARDP) Peptidase S15 {ECO:0000313|EMBL:ABL71087.1} KW=Complete proteome; Reference proteome OX=318586 OS=Paracoccus denitrificans (strain Pd 1222). GN=Pden_3004 OC=Rhodobacteraceae; Paracoccus.
Sequence
MRKGLSASAVLALLAFPAHGETLTLTLDRGIAATLEMPAGHGRFPAVLMFHGLGSSRDEV
GIIFADTATALAMDGIASLRIDFRGFGKSDGDTGAFTLERQNEDAAIALQALAAMDKIDA
ERIGLMGFSFGAGAAIELAAAQPETIKSLVVWAPVGNYHDDMLDSLGQRAFDLAERDGIV
GLDLGWRTMALKRDFFDGLNRHDLLAALRAYDAPFMVVNGSDDPYRKYTPALMQAAAGAE
KRALVIEGGDHVFHVYTPSRSLAPEVIEATVERFRDTLGKTR
Download sequence
Identical sequences A1B6E3 O54025
gi|119385728|ref|YP_916783.1| 318586.Pden_3004 WP_011749274.1.12501 WP_011749274.1.25907 WP_011749274.1.28967 WP_011749274.1.3707 WP_011749274.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]