SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1B7G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1B7G8
Domain Number 1 Region: 83-215
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.63e-22
Family GntR ligand-binding domain-like 0.028
Further Details:      
 
Domain Number 2 Region: 8-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-20
Family GntR-like transcriptional regulators 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1B7G8
Sequence length 223
Comment (tr|A1B7G8|A1B7G8_PARDP) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABL71462.1} KW=Complete proteome; Reference proteome OX=318586 OS=Paracoccus denitrificans (strain Pd 1222). GN=Pden_3389 OC=Rhodobacteraceae; Paracoccus.
Sequence
MDIEKQWPRGQRAAFVANFIRDQIVSGELAASTRINERVLTEQLGVSRTPLREAFKILES
EGLLTIEPNRGAMVTAISPQEVELAIEVLIALESVAAERACKHATDAQIDEIQALHDEMV
GAWKAGALMRYFHINQTIHQKIVDCAANPTLSRLYMAESQRIRRFRYAGNQISDRWARAV
YEHEQILDALRHRQGALLREVLRSHHLSGWRTTRAVLEGEIRL
Download sequence
Identical sequences A0A1I5KBM7 A1B7G8
gi|119386103|ref|YP_917158.1| WP_011749640.1.25907 WP_011749640.1.28967 WP_011749640.1.3707 WP_011749640.1.52621 WP_011749640.1.52749 318586.Pden_3389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]