SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1B9W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1B9W3
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.42e-28
Family GntR ligand-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1B9W3
Sequence length 175
Comment (tr|A1B9W3|A1B9W3_PARDP) GntR domain protein {ECO:0000313|EMBL:ABL72307.1} KW=Complete proteome; Reference proteome OX=318586 OS=Paracoccus denitrificans (strain Pd 1222). GN=Pden_4243 OC=Rhodobacteraceae; Paracoccus.
Sequence
MRSLQTLGLTRSRSGSGSFVISDRQAPELAYGNYSARELIEARPFIEIPAAGWAALRRSE
EDMARLLQLCDSMERQEDALKWVRLDSDFHCLIAEAARNRLFARIVTDSRDSLMRQSELV
NLMADRRVTSNHEHRRIAEAIAAGSETEARTAMRDHLHEVEQAMTWIISQRPANS
Download sequence
Identical sequences A1B9W3
2005169798 gi|119386948|ref|YP_918003.1| 318586.Pden_4243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]