SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1BAC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1BAC0
Domain Number 1 Region: 97-233
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.44e-25
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.38e-19
Family GntR-like transcriptional regulators 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1BAC0
Sequence length 269
Comment (tr|A1BAC0|A1BAC0_PARDP) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABL72464.1} KW=Complete proteome; Reference proteome OX=318586 OS=Paracoccus denitrificans (strain Pd 1222). GN=Pden_4400 OC=Rhodobacteraceae; Paracoccus.
Sequence
MTNASVKSERAAEAVAQHLESLILEGSLRPDERLLPERELAERLNVSRSTLRDGLKILEE
RGLLTSAGGRGSRVAALGKAAITDPLIAMLVRHAEAADDYLEFRGIVESAAAALAAQRAT
EVELARIRDCLGRMDRAHARADTGEEAEADTELHLLIYEASHNMTLLQIMQALAGVLRSD
VIQNRSRLFAVPAIRELLRQQHRAIAEAILARDAQAARQAAGEHIGYLRQASREIREAEA
RLDLSLRRLNGGGAGTRAAGTKSTPAAEG
Download sequence
Identical sequences A1BAC0
WP_011750626.1.25907 WP_011750626.1.3707 WP_011750626.1.52749 gi|119387105|ref|YP_918160.1| 318586.Pden_4400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]