SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1BBN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1BBN4
Domain Number 1 Region: 14-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.84e-20
Family LexA repressor, N-terminal DNA-binding domain 0.084
Further Details:      
 
Domain Number 2 Region: 97-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.36e-19
Family GntR ligand-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1BBN4
Sequence length 232
Comment (tr|A1BBN4|A1BBN4_PARDP) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABL72928.1} KW=Complete proteome; Reference proteome OX=318586 OS=Paracoccus denitrificans (strain Pd 1222). GN=Pden_4868 OC=Rhodobacteraceae; Paracoccus.
Sequence
MAETETFPERRRGSGVKLVYDLLRDEILDLVLPPGSPIDEVQLAERFGMSRTPIREALVR
LAGEGLVETLPNRSTMVANIDFLNMHTFFDALTLMYRVTTRLAASYHQPADLEIIREHQA
RFTAAVEAQDALAMIASNRDLHAAIAEAGRNPYYLSLFLRLLDEGRRLLRLYYQSFNDRL
PREYVDEHEAMIAAIEARDVELCDRLAKAHADQIVRQIQQFLARDQRQSLPL
Download sequence
Identical sequences A1BBN4
WP_011751087.1.25907 WP_011751087.1.3707 WP_011751087.1.52749 gi|119387590|ref|YP_918624.1| gi|119387590|ref|YP_918624.1|NC_008688 318586.Pden_4868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]