SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1BFR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1BFR7
Domain Number 1 Region: 251-367
Classification Level Classification E-value
Superfamily OmpA-like 6.28e-33
Family OmpA-like 0.0011
Further Details:      
 
Domain Number 2 Region: 79-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000296
Family Glycosyl hydrolases family 16 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1BFR7
Sequence length 369
Comment (tr|A1BFR7|A1BFR7_CHLPD) OmpA/MotB domain protein {ECO:0000313|EMBL:ABL65244.1} KW=Complete proteome; Reference proteome OX=290317 OS=Chlorobium phaeobacteroides (strain DSM 266). GN=Cpha266_1209 OC=Chlorobium/Pelodictyon group; Chlorobium.
Sequence
MKFVSRNFPILALMTLFMFGQLSSAFAKQTGSNKADIVWNRYDFVPGDKIIFEDNQETES
NGEFPSKWELVDKDNIEIATVNGNNVLYFIKCNMNSGGGLVPRMKNTGIDYLPDEFTVEF
DAYFENSNKPAYYLYLTDTKHQRKLEKTAPSKTPHNHRNIQFDRVMAKVYGGAANYYPGM
TATSKPPSMWRHFAISYNKGYVKVYIDDARVLTIPDLGYNPTGIGIGSHITGTKNKGYIK
NVRIAAGSVKLYNSLMAKGRIATTGIKFDTGNATLKPESNGVINEIVKMMNTYPVIRLRI
EGHTDSDGDTSANQILSEKRSAAVKAALIKRGIAAVRLSISSFGETKPVADNTTSEGKAN
NRRVEFVKL
Download sequence
Identical sequences A1BFR7
290317.Cpha266_1209 gi|119357024|ref|YP_911668.1| WP_011745068.1.8298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]