SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1R3C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1R3C6
Domain Number 1 Region: 34-362
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.22e-60
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000546
Further Details:      
 
Domain Number 2 Region: 361-516
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-28
Family Glycosyl hydrolases family 32 C-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1R3C6
Sequence length 519
Comment (tr|A1R3C6|A1R3C6_PAEAT) Putative levansucrase {ECO:0000313|EMBL:ABM06991.1} KW=Complete proteome; Reference proteome OX=290340 OS=Paenarthrobacter aurescens (strain TC1). GN=AAur_0948 OC=Paenarthrobacter.
Sequence
MTYDISRRTALQGASAGAIALFLCNAAPVAAHAQTSLRAVYHMTPPSGWLCDPQRPVHTN
GAYQLYYLHSSQNNGPGGWDHATTGDGVAFTHHGEVMPLQPDFPVWSGSAVVDIANTAGF
GAGTVVALATQPTGGIRKFQEQYLYWSTDGGYTFSALPDPVIVNTDGRSAATQAEIENAE
WFRDPKIHWDGARNEWVCVIGRARYAAFYTSANLRDWNWKSNFDYPNHALGGIECPDLFE
MTAGDGTRHWVFGASMDAYGVDLPMTFAYWTGTWNGAAFIADDLTPQWLDWGWDWYAAVT
WPSVEAPETKRLAIAWMNNWTYAAREVPTDASDGYNGQNSMTRELRLERQSGGWYSLLSS
PVGALQGYVTATTTLPDRTVNGSLVLPWNGRAYELEVHISWNLAANVGVSVGRSPDGSRH
TNIGKYGDELYVDRAPSDQDGYTLVPYTRAAAPIDANARSVHLRIFVDTQSVEVFVNSGH
TVLSQQVHFADGDSGISLYADGGPANFSGITIREFGNPL
Download sequence
Identical sequences A1R3C6
gi|119961221|ref|YP_946738.1| 290340.AAur_0948 WP_011773685.1.67142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]