SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1U5N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1U5N0
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.17e-49
Family Carbon-carbon bond hydrolase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1U5N0
Sequence length 281
Comment (tr|A1U5N0|A1U5N0_MARHV) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:ABM20299.1} KW=Complete proteome OX=351348 OS=VT8). GN=Maqu_3228 OC=Alteromonadaceae; Marinobacter.
Sequence
MEPLELEDQFVTTEAGYQLHYQSAGTGEPLIFLHGGGPGATSFGNFYYNAPAFLEQYQCF
FYNMPGYGQSSKLVVEAPMYSFHASMLAEFMDLVGIPRAHLVCQSFGGCAAIKLAIDHPE
RVNKLVLMGAQPMFGGVIDPLKLMSKHAANIILDYYGGEGPTPEKMRRLLADYEMHDDSK
LTDWTVNDRFANSTDPELLEVVRTPGFMGQPESLLGDLHRNVVPTLCLWGLHDWFGGPDV
PLLFLNQFANAQLFIEGQGAHHWQTELPERFNRVVLSYLSE
Download sequence
Identical sequences A1U5N0
gi|120556135|ref|YP_960486.1| 351348.Maqu_3228 WP_011786654.1.7233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]