SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1Z6M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1Z6M6
Domain Number 1 Region: 90-201
Classification Level Classification E-value
Superfamily TPR-like 1.66e-20
Family Tetratricopeptide repeat (TPR) 0.0032
Further Details:      
 
Weak hits

Sequence:  A1Z6M6
Domain Number - Region: 243-298
Classification Level Classification E-value
Superfamily NE0471 N-terminal domain-like 0.0157
Family NE0471 N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1Z6M6
Sequence length 396
Comment (tr|A1Z6M6|A1Z6M6_DROME) FI19323p1 {ECO:0000313|EMBL:AEX31654.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3189 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MKQMAAQKAWTDEERLELAAQLDAELDAFIDGLEKKRYEEGWPEDRWQEEMDKHPFFMKR
APQPGDDVHPMFEGLQKLKYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSFTEGIKT
KTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERFD
LCTQMCEELLEVDVDNEVAIALLHKNKMKKLEIERNQRKEAAEAKRRLTRFHRLRDAIEQ
RAIKFDDQKVGKKDVLSEELLYPKFLPLEDHPVHLDEDGSTLIWPAAFSYPEFLYSDFYQ
QLPETTTMRDCLATLLTEKLPYDKAHNYRLGNVHVYYENRKVGCVHKVDEEKQLAEIIAE
KGFFVSGGALLFYVVHKDSRVEQEFINERRRPMVYS
Download sequence
Identical sequences A1Z6M6
7227.FBpp0085479 FBpp0085479 FBpp0085479 FBpp0085479 NP_001260729.1.81976 NP_525106.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]