SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1Z7R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1Z7R9
Domain Number 1 Region: 92-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000848
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1Z7R9
Sequence length 180
Comment (tr|A1Z7R9|A1Z7R9_DROME) Uncharacterized protein {ECO:0000313|EMBL:AAF58972.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG42382 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSLVADYSDSSESDEDSSGQFSEDGETKSAAPAKNEKTPPPKLPSASQAFSQGAGKGDVF
NNPFLEAELHKTASLERHVKMVDNDAHQKLKNGRKICWNFRRGRCRFGTSCQYAHDSDLS
VDEAAEKSALPDQSVPVVVEAAPGNFNRRKRPGLGDALEPGKRVMKSYKQQNPQNPFARR
Download sequence
Identical sequences A1Z7R9
FBpp0289271 7227.FBpp0289271 FBpp0289271 FBpp0289271 NP_523665.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]