SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1Z830 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1Z830
Domain Number 1 Region: 70-200,284-372
Classification Level Classification E-value
Superfamily alpha/beta knot 6.54e-52
Family Hypothetical protein MTH1 (MT0001), dimerisation domain 0.0018
Further Details:      
 
Domain Number 2 Region: 184-265
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.05e-16
Family Hypothetical protein MTH1 (MT0001), insert domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1Z830
Sequence length 485
Comment (tr|A1Z830|A1Z830_DROME) Uncharacterized protein, isoform A {ECO:0000313|EMBL:AAF58861.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG12128 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MKTMLAAPTASSNGRPIGPHKSWKKVNEERKALKRQRKQDKLLKELQQAKEAESQAGKAA
NEVQAKDKPNPSTLSIAVPGSILENAQSNELRAYVAGQIARAACIFRVNEVIVFDDVGIA
TARETKRSYEADGEGSSTGTVRSSSLQLARILQYLECPQYLRKYFFPLHKDLKYSGLLNP
LDTPHHLRQQSKFRYREGVICDKKAKEGHSYANVGLLNDVLVDKAIEPGVRVTVKMEPQS
ESCRKQRGTLVSPDEPRRETGVYWGYQVRIAHSMSEIFTKSPYATGYDVTVGTSDRGTNV
HEVPNRSYNFNHMLIVFGGLQGLESALANDEKLTVDDPELLFDHYVNVLPRQGSRTIRTE
EALLIALAALQEKLQPQVADVEIDLTDLLPKSEDSGIAVRRDVLVSKKQKKRKQVEDTPD
ETVVDEPSFSKPLPKVARLTANPFADSSEELAKNTPAQDDFEVVSSTTVSGTSHSCADDD
LSRFD
Download sequence
Identical sequences A1Z830
NP_610543.1.81976 7227.FBpp0087481 FBpp0087481 FBpp0087481 FBpp0087481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]