SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1Z9L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1Z9L3
Domain Number 1 Region: 582-1197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-133
Family Tandem AAA-ATPase domain 0.061
Further Details:      
 
Domain Number 2 Region: 277-361
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000157
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1Z9L3
Sequence length 1242
Comment (tr|A1Z9L3|A1Z9L3_DROME) Peanuts {ECO:0000313|EMBL:AAF58294.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG8241 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDELQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRTYDTFRKALLDNGAEFP
DSLVQNLQRIINLMRPSRPGGASQEKTVGDKKEDKKSQLLKMFPGLALPNDTYSKKEESD
DDEKVKAKPEKHSETHKKTDMSDVDAAMMELEALAPGEGATLVRPHKEVSSRDRHKRRSR
DRDTKRRSRSREDRHSDRRRSRSRDKERRRRSRSRDNRRRSRSREDRDRDRDRRHKSSSS
RDHHERRRRSRSRSTERRDRRDRSRDCSEKMPPPSAAMTDDPEAGKIYSGKIANIVPFGC
FVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMSITGQKVSLSMKEVDQ
DSGKDLNPLSHAPEDDESLRDRNPDGPFSSSTSMLNLQGNGMEGDEHESRKRVTRISSPE
RWEIKQMISSGVLDRSEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSGHGRALHDL
SPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEIEAMPTSLNKNWIDPLPEDESR
SLAANMRGMAAAPPEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLPIYKLRDDLIKAVT
DNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLG
QEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFG
LLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDA
SLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSE
MQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPI
SQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGIND
LLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVAL
QCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSN
AWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKD
PQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPS
FFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
Download sequence
Identical sequences A1Z9L3
FBpp0086647 FBpp0086647 NP_610928.1.81976 7227.FBpp0086647 FBpp0086647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]