SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1Z9N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1Z9N6
Domain Number 1 Region: 371-738
Classification Level Classification E-value
Superfamily L domain-like 5.53e-60
Family Internalin LRR domain 0.015
Further Details:      
 
Domain Number 2 Region: 176-404
Classification Level Classification E-value
Superfamily L domain-like 6.05e-39
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 3 Region: 669-905
Classification Level Classification E-value
Superfamily RNI-like 4.16e-34
Family 28-residue LRR 0.02
Further Details:      
 
Domain Number 4 Region: 101-210
Classification Level Classification E-value
Superfamily L domain-like 0.00000000403
Family Ngr ectodomain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1Z9N6
Sequence length 1092
Comment (tr|A1Z9N6|A1Z9N6_DROME) Convoluted, isoform B {ECO:0000313|EMBL:AHN56214.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG8561 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MIQLRLRTLVLLHFIALASSEYVYGEPEFKCPKKSKALYPCECVKGSDNGLYIRCENTNL
ATLSVALQNLASFGMPIEELTIYRGHFVRLYGPLFAHIKARMLIIEETPLATIEDYVFYG
VNNTLEQLHLLRTNLSHVGLLGFGILGKAKELVIDGHAFQQLPKDLFAGQEIANSLGIIR
VTNGNLSDLPIETFQPLRKLKTLDLHGNQLENLKRNQFKNLRELEVLDISHNQIKKLEAQ
HIADLTKLGWCNVSHNALSELSRGTFARNSVLKVLHLSHNQIARLDANSFRGMRFLRRLF
LSDNVLTDIGRGTFGSIARIGTIDLARNRLKKIEFQMFTQMNYVELLDLAENNITKIEKN
SFKDIYQAIINVSHNALELIETAAFENCVNITVLDLSHNRLANFSRRSFDETTFATYFQL
SYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPKNCFPKLYELHTIDVSHNNISSIFNGV
FQTLFSLRSIDLSHNSMREIKSSTFGTLPTLLEMDLSHNELVSVVRGSLAKLTSLRQLYL
NNNQLEKLFQLPISLNELYFSHNRLTNIPSGTWPVMNSLIYLDLSHNQLGDTLNGESFTG
LLVVQRLKLQNNGISQPPKDAVAVMSTLQYLHLENNNITTLERSAFGKLPVLFELNLYGN
QVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVGLPSLRNLDLSFNSLTKLDNKTNGV
LDDLLSLETLDLSHNRISFVTKKTFPSHQYIPYNLRNLNLSYNLMPILTYDITFGTKKLV
RLDVSHNQINDLRRGVISNFTSLQSLDMSYNELSNLKSEEHIFDLPQNLSWLDLSHNKIY
HLPFANLVKVKSLKYVDLTNNSLEDVPASIVGSMRNGSQVLLAGNPLHCGCNARPLKYFM
LQQTIAGEDLKSIYCGTPALIKDKQLISLDDEYLHCAEDEQEMYKGIDYEQLTDVRFREV
KTNKAGMLTLCWYVSGFSDVSDFHVYIRSSSNDVLHQSDYAYNNRTAQIPVEELSTLGEE
KLRGAEICIVSRDSDGNTRKWFSGQCQQLPSLKRPRTFFFGNFQVRGGVSRTSSSLPRCL
LYIILVLFVARL
Download sequence
Identical sequences A1Z9N6
NP_001286416.1.81976 NP_610948.2.81976 7227.FBpp0086669 FBpp0086669 FBpp0086669 FBpp0086669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]