SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2AH53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2AH53
Domain Number 1 Region: 68-202
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-22
Family FAD-linked reductases, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2AH53
Sequence length 203
Comment (tr|A2AH53|A2AH53_MOUSE) Sarcosine dehydrogenase, mitochondrial {ECO:0000313|Ensembl:ENSMUSP00000120478} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Sardh OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASLSRVLRVAATCPRGRAAWNLGLQPLATEARPTTEKSVPYQRTLKEEAQGASVVPQGP
SQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPS
DVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIES
HVLSPAETKSLYPLMNVDDLYGT
Download sequence
Identical sequences A2AH53
ENSMUSP00000120478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]