SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2AHD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2AHD2
Domain Number 1 Region: 6-34,74-135
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-22
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 139-249
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-21
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2AHD2
Sequence length 324
Comment (tr|A2AHD2|A2AHD2_MOUSE) Potassium channel subfamily K member {ECO:0000256|PIRNR:PIRNR038061} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Kcnk15 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MRKQSARTAALILCILSYLLVGAAVFDALESEAERSRQRLLARKRGEFRRKYRFSADDYR
ELERLALQAEPHRAGRQWRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPL
TLVTFQSLGERLNTLVRCLLLTAKRCLGLRRPHVSAENMVVAGLLLCAATLALGAIAFAH
FEGWTFFHAYYYCFITLTTIGFGDFVALQRDEALQRKPPYVAFSFLYILLGLTVIGAFLN
LVVLRFLASSDAPERAVHRRVSVFRRGAPESRVRAGASTCIPYPFHQLETWARDNPAFSP
PLSPEATHHCHSSPDRPRARRKSI
Download sequence
Identical sequences A2AHD2
ENSMUSP00000105023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]