SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2AW99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2AW99
Domain Number 1 Region: 124-295
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.14e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 2 Region: 273-391
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-31
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2AW99
Sequence length 707
Comment (tr|A2AW99|A2AW99_DANRE) Si:ch211-239f4.1 {ECO:0000313|Ensembl:ENSDARP00000105280} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:ch211-239f4.1 OC=Cyprinidae; Danio.
Sequence
MSSPSSSPEREGGMAGSVQLEDLNSPAGLEIDPPFIGSPVLSPDSSSHDAALSAPAASPA
DSENLSPDELELLAKLEEQNRLLEADSKSMRSMSGSRRNSGSSLVSSSSASSNLSQLEED
TWILWGRIVNEWDEWRRKKDKLLKELIRKGIPHHFRAIVWQLLCNATDMPVKNQYSELLK
MSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGL
LLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEHLLQEQLPELNVHFRSQS
FHTSMYASSWFLTLFLTFLPLPIATRIFDIFMYEGLEIIFRVGIAILQYNQTDLIQLDME
GMSQHFQKVIPHQFDSCPDKLILRAYQVKYNPKRMKKLEKEYTTIKNKEMEEQIEIKRLR
TENRLLKQRIETLEKGQVTRAQEAEENYVIKRELAVVRQQCHTASESLEKAQDTIRELQQ
HKYTEEFVSGLQTQLEQSRLQEAELLGALKEMQDKVLDLEKRNSSLPDEINVAQLQEELK
LVKLREQETLRSFREMQEAVTDLNHCWQHHTSRGGGGGGGGHWKESPKKNAMNELQDKLM
SLRLREAQGQAELKEVKLKNLQLESQNQINGKLLGRHEQESTSLQERLQNALSHNKTLQS
QLNEMKRKQAESDCKSKEEVMAVRLREADSMAAMAELRQKIADLEIQ
Download sequence
Identical sequences A2AW99
7955.ENSDARP00000069169 ENSDARP00000105280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]