SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BDL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BDL4
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-30
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 147-191
Classification Level Classification E-value
Superfamily LCCL domain 0.00000405
Family LCCL domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BDL4
Sequence length 289
Comment (tr|A2BDL4|A2BDL4_DANRE) Discoidin, CUB and LCCL domain-containing 1 {ECO:0000313|Ensembl:ENSDARP00000113311} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=dcbld1 OC=Cyprinidae; Danio.
Sequence
MSGHTVLYGLILLYSIHPLVLAEKPDDGCGHYVLGQESGVLSSKNYPGTYPNNSWCEWRI
RVPIGHTIILKFGDLDMKKRDCESDYLKVLKGSYGSENVYWEYCGDPMPKPSQLHTDSNE
LTIRFRSSQHITGRGFLLSYSTENHKELLTCLDRGSHFTTAKYRKYCPAGCAALAGEVSG
DISLGYRHVSSGSLFSSGVSDKQRLILQENVSQACRVIYSFNMHPSRCSAGSFPNRFHMQ
SVSQQKKTASFVLLYGHLCAFLFLVLLVILAVNANIILLNSELLALLNY
Download sequence
Identical sequences A2BDL4
7955.ENSDARP00000091712 ENSDARP00000113311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]