SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BJ40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BJ40
Domain Number 1 Region: 16-202,327-408
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.43e-54
Family Bacterial dinuclear zinc exopeptidases 0.0019
Further Details:      
 
Domain Number 2 Region: 205-319
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.89e-19
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BJ40
Sequence length 409
Comment (tr|A2BJ40|A2BJ40_HYPBU) Acetylornithine deacetylase related protein {ECO:0000313|EMBL:ABM80001.1} KW=Complete proteome; Reference proteome OX=415426 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5). GN=Hbut_0126 OC=Pyrodictiaceae; Hyperthermus.
Sequence
MRVLDETDARTLHSYIIDLYKSFIPVKAIPPDMGGEGELERAKVLEDELRRLGLRVWRVD
ARDERARGGIRPNILAQLEGADTSRTLWIVAHMDTVPEGDRSLWRYEPYSVTVEDDYVYG
RGVEDNGQAIVVAFAVAKYLVERGVKPRVNLGIALVSDEETGSRYGLQYLLSQNVFGTPE
SNWFLVPDAGSPDGSKVIVAEKHILWFKIRVVGMQAHASTPHEGINAHRLGMMFNLELDR
ILHTRFTRYDPIFEPPVSTFEPTRKEENVSNINTIPGVDTVYWDARILPSYSIDEVVETV
KSTAYSFASSHGIKVEVEIVARDDAGEPTSPDHPFTRAFLRAIREARNVEPKLLGIGGGT
IARYLRKKGYPALVWMTCEETAHKPNERARLSSILADVDTVLYYLLHVA
Download sequence
Identical sequences A2BJ40
415426.Hbut_0126 gi|124027026|ref|YP_001012346.1| WP_011821318.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]