SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BKC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BKC4
Domain Number 1 Region: 8-112
Classification Level Classification E-value
Superfamily Prefoldin 1.31e-18
Family Prefoldin 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BKC4
Sequence length 126
Comment (tr|A2BKC4|A2BKC4_HYPBU) GimC subunit beta {ECO:0000256|HAMAP-Rule:MF_00307} KW=Complete proteome; Reference proteome OX=415426 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5). GN=Hbut_0575 OC=Pyrodictiaceae; Hyperthermus.
Sequence
MAQRLPPELENKLVRLQTLQAQYNKILQERATVESEIAETQRAIKLIEEAGENAPVYRME
ANVMVRVDRAKLLQELKDRLEILELRLQRLKKQEEEIRKQLDTLAKEIRELQTKLALGKQ
AGAGAS
Download sequence
Identical sequences A2BKC4
415426.Hbut_0575 gi|124027460|ref|YP_001012780.1| WP_011821753.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]