SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BL09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BL09
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000389
Family GHMP Kinase, N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BL09
Sequence length 119
Comment (tr|A2BL09|A2BL09_HYPBU) Uncharacterized protein {ECO:0000313|EMBL:ABM80670.1} KW=Complete proteome; Reference proteome OX=415426 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5). GN=Hbut_0817 OC=Pyrodictiaceae; Hyperthermus.
Sequence
MTVSRVRVKAPSSIANLGVLFDLAALAVSYAYDTVTVEVVGRQSSEPRVEVEAVGAPSGE
SNTAYVAARKLLEYLDEKLHVRILLRRAYRPAWVSGVVVLQRQPRCTLSTRSLVVLSSR
Download sequence
Identical sequences A2BL09
gi|124027695|ref|YP_001013015.1| 415426.Hbut_0817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]