SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BLH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BLH1
Domain Number 1 Region: 5-77,168-341
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.01e-82
Family Pyruvate kinase 0.0000166
Further Details:      
 
Domain Number 2 Region: 323-447
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 4.12e-19
Family Pyruvate kinase, C-terminal domain 0.0083
Further Details:      
 
Domain Number 3 Region: 72-165
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000000227
Family Pyruvate kinase beta-barrel domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BLH1
Sequence length 466
Comment (tr|A2BLH1|A2BLH1_HYPBU) Pyruvate kinase {ECO:0000256|RuleBase:RU000504} KW=Complete proteome; Reference proteome OX=415426 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5). GN=Hbut_0985 OC=Pyrodictiaceae; Hyperthermus.
Sequence
MQHLRVKIIASIGPSSGSPEVILRLAELGVSGFRINFAHGEPSLWREWAEYVREAERKTG
RPLALIGDLVGPSIRLGRVKNPIKLNAGDRAEFRCVEESEGGDTKIIPLPVRRVYEVLDE
GDLIVMDDGRVRLRVLEVSGYSAIVEALTPATITSRKAIAIRGKDPGLPTLSQRDVEHVK
FALDNGFDYIALSHVRTRDDVDALRLIVLREGGDAGIAVKIENKSAVENLQDIIRAADLV
VVARGDLGMTYGLEEVPVLQERIVAAARSVGKPVIVATQLLESMIENPVPTRAEVTDVYV
AVRQGVDGLMLTGETAIGRYPIEAIRWLRKIITRAEQVLHIERYTPKDKRWAYAASIVET
AEKLSAALILVYSITGSLPPWIAASRPMVPVVIGTGSPQRARRLAVLWGLDVRIVEAGGY
EEGLAKLEDVLSEEGLLSEGDVIVEAYRETEHKQVIVVKRVFKGLT
Download sequence
Identical sequences A2BLH1
gi|124027857|ref|YP_001013177.1| 415426.Hbut_0985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]