SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BMP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2BMP1
Domain Number - Region: 52-128
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000182
Family GHMP Kinase, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BMP1
Sequence length 283
Comment (tr|A2BMP1|A2BMP1_HYPBU) Conserved archaeal protein {ECO:0000313|EMBL:ABM81252.1} KW=Complete proteome; Reference proteome OX=415426 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5). GN=Hbut_1428 OC=Pyrodictiaceae; Hyperthermus.
Sequence
MWRGSPRETGSLGAGLLLEPPAVAEVYECPGGECGLRVRACGELVSASTSIVKHVVELLG
GLNVDVSLESPAPLAVGYAVSAAIALAIAIGEGSRRGWSVEASAAVAHEAEVLAGTGLGD
VVAMVYGRGLELRLAPGAPGLARVESFPVNAKTIYSLELGRMATTEMHRALGEKLVALAA
PRWQRIAENPNLDTFLREAREFSVEAGFAPDWLREKLDRLVSRGLVRGWYVKKRVAIVVP
EDDAAGEAREELEALAAKRGLRLRRHRPAGSPLSVEPCYSSFM
Download sequence
Identical sequences A2BMP1
gi|124028277|ref|YP_001013597.1| 415426.Hbut_1428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]