SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BUE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BUE7
Domain Number 1 Region: 5-376
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.51e-76
Family Cystathionine synthase-like 0.000000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2BUE7
Sequence length 381
Comment (tr|A2BUE7|A2BUE7_PROM5) NifS-like aminotransferase class-V {ECO:0000313|EMBL:ABM71408.1} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_01991 OC=Prochlorococcus.
Sequence
MFSSPILLDYQSSTPCLEDVVNSMSPYWREIFANTSSKSNLAGINASAILEVSREKIQEY
LCLKKKKVIFTSGATESNNLALLGFARNFYKETKSYGHIITLKTEHKAVLEPLDQLRKEG
FHITAITPEKDGLISKEKFMSFIRDDTFLVSIMMANNEIGVIQPLKEISEICKSREIILH
SDYAQCLGSLELDNLDSVANMLTISSHKIYGPKGVGLLLIDRDIELQPLFFGGGQEFGLR
SGTLPLALIVGFTKAIEIAVFNQKKNAEKFLFYRDKLLHGLLVNNSGVEINGSMKERLPH
NLNLTVLDVNGSKLHKTLKSKIICSSGSACGNGEPSHVLLALGRSFKEAEASLRLSIGLM
TTSEDIENSIQIITDTINLLR
Download sequence
Identical sequences A2BUE7
gi|123965434|ref|YP_001010515.1| 167542.P9515_01991 WP_011819522.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]