SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BUG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BUG3
Domain Number 1 Region: 29-358
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-63
Family AAT-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BUG3
Sequence length 369
Comment (tr|A2BUG3|A2BUG3_PROM5) Aminotransferase {ECO:0000256|RuleBase:RU000481} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_02151 OC=Prochlorococcus.
Sequence
MSEFNKINNLPPTPRKEIINMQSYSAPLENRRNLLRLDFNENTLGPSQKVYEAIKDIKLN
QISIYPEYNLLKNFLSHNYYESRQFDSEEIGLFNGADAVINAIFHSFGDRDEIFLTTNPT
FGYYSPCSEIQGMKKITCSYEGEHFLFPIKRFEEKIIKHKPKLIFICNPNNPTGTVLSAQ
EIIKLANLNKSSLIVVDELYEKFNGDSLLPKIDFQEIKNIVIIQSLSKTAGLAGLRIGFA
FGNKSIIQYINKVTGPYDVNSFAVTAALAALNDKSYIDNYVTEVNKARLFIEKKFESLSI
RTHFGAGNYFLIWPNQNPEILTRKMRERGILIREMKNKKDIENSVRVSIGTQEQMLRFWS
TYKELDLNN
Download sequence
Identical sequences A2BUG3
WP_011819538.1.83733 gi|123965450|ref|YP_001010531.1| 167542.P9515_02151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]