SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BUR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BUR5
Domain Number 1 Region: 17-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.48e-104
Family GABA-aminotransferase-like 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2BUR5
Sequence length 404
Comment (tr|A2BUR5|A2BUR5_PROM5) Putative pleiotropic regulatory protein {ECO:0000313|EMBL:ABM71526.1} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_03171 OC=Prochlorococcus.
Sequence
MINMQIPPFTLERQFKEIGSDIEDAVLKVLKGGQYVGGHEISRFEENFASLIGVNHAIGC
NSGTDALILALRALDIGEGDEVITSSFSFFATAEAISAVGANPVLVDINPTNYLINIDLI
EREINSNTKAIMPVHLFGNAVNMKSIKVLAKKYDLKIIEDCAQATCTLWGNSKVGSIGDI
GCFSFFPTKNLGAAGDGGAVTTSDYNIARKVRELAVHGSPKRYHHTQIGYNSRLDTLQAA
VLNIKLKSLSKWISNRQKIANNYFELLEENSFLHFPMIDFDSISHSWNQFVIRLKNYNYD
INNNYSNLFETDFNKNNSLRNLLKLRLSEKGINSIIYYPIPIHAQIAYKNINFSREKLIN
TEIVCTEVLSLPMYPEISYEEQVYVSKNFNIILKKCIDELQICA
Download sequence
Identical sequences A2BUR5
gi|123965552|ref|YP_001010633.1| 167542.P9515_03171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]