SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BVS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BVS9
Domain Number 1 Region: 184-360
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.19e-54
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BVS9
Sequence length 364
Comment (tr|A2BVS9|A2BVS9_PROM5) Cell wall hydrolase/autolysin {ECO:0000313|EMBL:ABM71890.1} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_06811 OC=Prochlorococcus.
Sequence
MMSKFFFNKLFRCLSIFLLFNSSISPARSSSALAAWSLNSNGVLELRTKSNSKLKAYFQK
GGKNFGDRFWIDFPGELQTPRTIEGNGPIKEIRLGKPIKGKTRLVVEFSADNNNLKPLSW
RLVGIDQNTWKIKLFSLPKNSFQTIGEGLVSKSRINLKANKKLIKPRKTNYEFLQLPDIE
RNKFYVVLDPGHGGPDPGAIGIGGVKEADVVLDVSKRVRNLLSKKGVNVRMTRNKEVDLD
LPPRVSIANRTNADVFVSIHANASRGKRRDINGLETFYYTGWRGRLLAKKIQKQILKVSP
GSPDRGVRQGRFFVIKNTRMPAVLVEIGFLTGRLDARRLEKSIHRERIAYAITKGILEYL
SKAG
Download sequence
Identical sequences A2BVS9
167542.P9515_06811 gi|123965916|ref|YP_001010997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]