SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2BW87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BW87
Domain Number 1 Region: 177-418
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-69
Family Extended AAA-ATPase domain 0.0000000432
Further Details:      
 
Domain Number 2 Region: 432-629
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.09e-66
Family FtsH protease domain-like 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BW87
Sequence length 637
Comment (tr|A2BW87|A2BW87_PROM5) ATP-dependent zinc metalloprotease FtsH {ECO:0000256|HAMAP-Rule:MF_01458} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_08411 OC=Prochlorococcus.
Sequence
MNQKLKTIILWALPIILVIALSYQFLSTSNVDNLKSNGTTIAPKNTAVARVSYGRFLDYI
KSGRVTSVDIFDGGRNAVVETVDSDLDNKVQRLRVDLPGLTPELINNLKNEGISFDVHPV
KATPPALGILGNLLFPAILIGGLILLARRSNGMPGGPGQAMQFGKSKARFAMDANTGVVF
DDVAGVNEAKEDLEEVVTFLKKPEKFTSVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGV
PFFSLAGSEFVEMFVGVGASRVRDLFKKAKENSPCLIFIDEIDAVGRQRGAGIGGGNDER
EQTLNQLLTEMDGFEGNSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSIL
EVHSKNKTLQEDLTLESIARRTPGFTGADLANLLNEAAILTARRRKKSISILEIDDSVDR
IVAGMEGSPLTDGRSKRLIAYHEVGHAIIGSLVKAHDPVQKVTVIPRGQAKGLTWFTPDD
DQSLISRANLKARIMGALGGRAAEDVVFGRGEITTGAGGDFQQVAQMARQMVTRFGMSDL
GPIALESGNQEVFVGRDLMTRSEVSDSISKQIDESVRVMVKDCYKETYSIISKNREAMDK
LVDLLIERETLDGEEFVKILSEFTTVPEKERTPQLLN
Download sequence
Identical sequences A2BW87
gi|123966074|ref|YP_001011155.1| WP_011820153.1.83733 167542.P9515_08411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]