SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2BYP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BYP4
Domain Number 1 Region: 118-244
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-30
Family NlpC/P60 0.0000229
Further Details:      
 
Domain Number 2 Region: 19-90
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 0.00000000000000623
Family Spr N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BYP4
Sequence length 251
Comment (tr|A2BYP4|A2BYP4_PROM5) Uncharacterized protein {ECO:0000313|EMBL:ABM72905.1} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_16981 OC=Prochlorococcus.
Sequence
MKKNIDPISLFKQTNFSNTIWWEVKINISGYQNETENNLVTEIFKNRIFKLIYPTPYQSK
KRLSRILVQFYEDGYICWIDLDKLIIEKFNFNNSFIKSDEIFIREKIPLVLNWIKNQSKL
KNQYLWGGTIGPNFDCSGLIQTAFLNYGIYIPRDSYQIKSFCRHLFNFTEIKYSLEKGDI
LFFGNSKKCDHVGIYKGEGLYYHCSGNDFGRNGIGIDTLKKTNDRISLHYQSKLISAGRI
FRSFRWDKTIR
Download sequence
Identical sequences A2BYP4
167542.P9515_16981 gi|123966931|ref|YP_001012012.1| WP_011820997.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]