SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DGI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2DGI4
Domain Number - Region: 128-205
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0612
Family Calponin-homology domain, CH-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2DGI4
Sequence length 356
Comment (tr|A2DGI4|A2DGI4_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAY20580.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_239570 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MKKSKAHFLWLLYTLSDKCNDTKAKELCQNLDAMDSQEFLGYFSDIKTYILLTNYIFDVN
TDAPIDILHNHGYYRYGDASIFAKSNFDEIAFINLIECYMWASLDRKIPTNVLVKKVGRT
KVFSLNDPEAIICSWINTCCSTYTKLRPVTSISQYFIGSNQFRALLYSYTRDESLLQYSD
PKTNAEISLRTCSTYGIKQTFEYENYQQSPLVIMCFLVDAIAKLDSIKPLPRPRTISRMD
MQRIEKNISDTKKEVESLKIRCGVLANDVNLIAARLVRMKRPSTSISAVKSKPQLPVQMQ
FPDGPGLPPLHDLQSDIPDDRPKSALHVKWEIPVEMLSNRGGGKLKDPQSSPVESL
Download sequence
Identical sequences A2DGI4
gi|121915794|gb|EAY20580.1| gi|154417090|ref|XP_001581566.1| 88273.m00331 5722.A2DGI4 XP_001581566.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]