SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2DKT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DKT4
Domain Number 1 Region: 4-226
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.68e-63
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 793-1027
Classification Level Classification E-value
Superfamily HCP-like 3.51e-41
Family HCP-like 0.00075
Further Details:      
 
Domain Number 3 Region: 1039-1135
Classification Level Classification E-value
Superfamily HCP-like 6.02e-16
Family HCP-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2DKT4
Sequence length 1137
Comment (tr|A2DKT4|A2DKT4_TRIVA) Actinin, putative {ECO:0000313|EMBL:EAY19067.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_247460 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MTRTWEETQINTFTKWMNSYLKQRKLNINDIKTDLCDGTILINLCEILSKKPFPSRWHKN
PKQKVQMLENCHMAVDFIQNTLKIKLVGIGGEDVLNGTLKLILGLVWSVINKFQVEAIKE
DLAEGEQISGRDKLLQWAKESTANHNGVNIVDFSKSWHGGLPFCAILHHYLPEIVDYDSI
TPENSINEAFLVMNECGINVFLDPQDLEVEAPDEKSVVTQVSELYHFFKKPENIAAAKRN
ADRRKYILATIKKMVNESEGDLHDALVVMSKNIDTLLEDPALNFCPLCAEFFETIEKLYA
LLKNPKVPADALQQIENLNKQLLEFQEKVKQLDEEKAQKEKEAEELKQQNNAKEQELQNL
KNEKEAKEKELEEVKNEKAAKEQELENVKNEKTAKEQELENIKNEKEAKEKELENVKNEK
AAKEQELENVKNEKAAKEQELENVKNEKTAKEQELENIKNEKEAKEKELEEVKNEKTSKE
QELENVKNEKAAKEEQLAKMTTDFEQKNNESGNLSSELEQLKQQLAAAQQQNEQLNIMIK
AKDNEMNAVIARANEQLQNLNQQKDEELKKKDDEINAIKEAKNSELAQLRSENEQNLAKK
DLLLQEKDQEIQKRFREIEDLNNNKEELLKQKDQEIEQMKNLQSQEEKRREAEVSELSQQ
IEQLKQLQSSGAQEAQNILIETQNKYSAQIAEKDKRIEELENAKSQLEKESEDRNEENKK
LLVQCSNLRDEVSSKDKALQESEKNLEEAKKEINVIVTKQKQSADDEAVKAAVEGYKEVI
AGLKCEYGHGVTKNDTEAFKHYTVAAKLNIAEGQFSLGRLLEQGRGNIKNERLAFQSYAR
AQNQNHYAAMNNMAAMLLTGRGVDKDEKLAAQKFKVAADNGNVAAQCNYGILLDKGTGVE
KNEIDAVRYFRLAANAGHPRAINNLAYKLENGSGIDKDHAEATKMFHQAASQGQSVAKFN
VSLYESDQEKVLNEWKLAASQNVPAAKNNIGVTMSDGILLPKNEEEGAELVKTAAEGGST
AAIFNYSIMLMNAKGVEENKKGAARLLKISSDKGYAKAMNNLGVMFIKGEVVKLAPLEGV
KMVRKAADELNDPDALFNMGLIFLKGLGVTADPAFAQNYFQKAAKNGNKTAELYLQQ
Download sequence
Identical sequences A2DKT4
88546.m00292 gi|121914266|gb|EAY19067.1| gi|154414049|ref|XP_001580053.1| 5722.A2DKT4 XP_001580053.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]